PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast01G158500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MIKC_MADS
Protein Properties Length: 197aa    MW: 22366.6 Da    PI: 8.8645
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast01G158500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF69.33.5e-22957149
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                        kri+n ++rq tf kRr g++KKA EL vLCda+ ++++fs +gkly y
  Brast01G158500.1.p  9 KRIDNPTQRQSTFYKRRDGLFKKARELAVLCDADLLLLLFSASGKLYHY 57
                        79*********************************************99 PP

2K-box271.9e-1073169298
               K-box   2 qkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenk 92 
                         +++++++++    ++ + el+++ k  + L++e+R +  +d e+ ++  L  Le++Le +++k+Rs K++ +  ++++l ++ +  q e  
  Brast01G158500.1.p  73 EAATQTKVWCDIRQERRAELENVGKMCDLLEKELRFMTVNDGEQYTVPSLAALEHNLEAAMRKVRSEKDRKIGGEMSYLENMIRGKQAERY 163
                         5667778999999******************************************************************999998888887 PP

               K-box  93 aLrkkl 98 
                          L  kl
  Brast01G158500.1.p 164 GLCDKL 169
                         777665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006627.978161IPR002100Transcription factor, MADS-box
SMARTSM004328.8E-31160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.7E-26288IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-22323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.2E-211057IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-222338IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-223859IPR002100Transcription factor, MADS-box
PfamPF014863.8E-1285169IPR002487Transcription factor, K-box
PROSITE profilePS512979.885175IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MGRGRSEIKR IDNPTQRQST FYKRRDGLFK KARELAVLCD ADLLLLLFSA SGKLYHYLAP  60
TVPSVKEFVE RYEAATQTKV WCDIRQERRA ELENVGKMCD LLEKELRFMT VNDGEQYTVP  120
SLAALEHNLE AAMRKVRSEK DRKIGGEMSY LENMIRGKQA ERYGLCDKLA HAQSLKEVEG  180
GSTSLNNGLD LKLGFN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4693140.0KF469314.1 Brachypodium distachyon MADS-box transcription factor 19 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001288316.11e-143MADS-box transcription factor 32-like
SwissprotQ8S1511e-126MAD32_ORYSJ; MADS-box transcription factor 32
TrEMBLI1HR491e-143I1HR49_BRADI; MADS-box transcription factor 19
STRINGBRADI2G48690.11e-142(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP119233439
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.14e-21MIKC_MADS family protein